Recombinant Mouse EPO-R/Epor Protein

Größe

£133.00

SKU:: RP01732
Zusätzliche Namen:: EPO-R|Epor
Molekulargewicht:: 30-35 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Ala25-Pro249
Formulierung:: Recombinant Mouse EPO-R/Epor Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala25-Pro249) of mouse EPO-R/Epor (Accession #NP_034279.3) fused with and a 6xHis tag at the C-terminus.
Spezies:: Mouse
Sequenz:: APSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP
Uniprot:: P14753
Synonyme:: EPO-R;erythropoietin receptor
Weitere Details:: Erythropoietin (EPO) is the major glycoprotein hormone regulator of mammalian erythropoiesis, and is produced by kidney and liver in an oxygen-dependent manner. The biological effects of EPO are mediated by the specific erythropoietin receptor (EPOR/EPO Receptor) on bone marrow erythroblasts, which transmits signals important for both proliferation and differentiation along the erythroid lineage. EPOR protein is a type a..., single-transmembrane cytokine receptor, and belongs to the homodimerizing subclass which functions as ligand-induced or ligand-stabilized homodimers. EPOR signaling prevents neuronal death and ischemic injury. Recent studies have shown that EPO and EPOR protein may be involved in carcinogenesis, angiogenesis, and invasion.

Versandbedingungen:: Blue Ice