Recombinant human SECTM1 Protein

Größe

£133.00

SKU:: RP01731
Zusätzliche Namen:: K12|SECTM|SECTM1
Molekulargewicht:: 20-25 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Gln29-Gly145
Formulierung:: Recombinant human SECTM1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln29-Gly145) of human SECTM1 (Accession #NP_002995.1.) fused with and a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG
Uniprot:: Q8WVN6
Synonyme:: K12;Protein K-12;secreted and transmembrane protein 1;SECTM;type 1a transmembrane protein
Weitere Details:: Secreted and transmembrane 1 (SECTM1), also known as K12, is a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein of SECTM family. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.