Recombinant Human HMGB2 Protein

Größe

£145.00

SKU:: RP01718
Zusätzliche Namen:: HMG-1,HMG1,HMG3,SBP-1
Molekulargewicht:: 25-35 kDa
Reinheit:: ≥90%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Met1-Glu209
Formulierung:: Recombinant Human HMGB2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu209) of human HMGB2 (Accession #NP_001124160.1) fused with and a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
Uniprot:: P26583
Synonyme:: high mobility group protein 2;high mobility group protein B2;high-mobility group (nonhistone chromosomal) protein 2;HMG-2;HMG2
Weitere Details:: High mobility group protein B2, also known as HMGB2, is a member of the non-histone chromosomal high-mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells