RP01710
Recombinant Human FGF-9 Protein
Größe
£145.00
- SKU:
- RP01710
- Zusätzliche Namen:
- FGF-9|FGF9|GAF|HBFG-9|HBGF-9|SYNS3
- Molekulargewicht:
- 25-30 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ala2-Ser208
- Formulierung:
- Recombinant Human FGF-9 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala2-Ser208) of human FGF-9 (Accession #NP_002001.1) fused with no additional amino acid.
- Spezies:
- Human
- Sequenz:
- APLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
- Uniprot:
- P31371
- Synonyme:
- FGF-9;fibroblast growth factor 9;fibroblast growth factor 9 (glia-activating factor);GAF;Glia-activating factor;HBFG-9;HBGF-9;heparin-binding growth factor 9;SYNS3
- Weitere Details:
- Fibroblast growth factor 9 (FGF9) also known as Glia-activating factor or Heparin-binding growth factor 9, is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells.
- Versandbedingungen:
- Blue Ice