RP01700
Recombinant Human Betacellulin/BTC Protein
Größe
£145.00
- SKU:
- RP01700
- Zusätzliche Namen:
- Betacellulin|BTC
- Molekulargewicht:
- 45-60 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Asp32-Tyr111
- Formulierung:
- Recombinant Human Betacellulin/BTC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp32-Tyr111) of human Betacellulin/BTC (Accession #NP_001720.1) fused with and a hFc tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
- Uniprot:
- P35070
- Synonyme:
- probetacellulin
- Weitere Details:
- Betacellulin(BTC) is a member of the epidermal growth factor (EGF) family. These soluble proteins are ligands for one or more of the four receptor tyrosine kinases encoded by the ErbB gene family (ErbB-1/epidermal growth factor receptor (EGFR), neu/ErbB-2/HER2, ErbB-3/HER3 and ErbB-4/HER4). Betacellulin is a 32-kilodalton glycoprotein that appears to be processed from a larger transmembrane precursor by proteolytic cleavage. This protein is a ligand for the EGF receptor. BTC is a polymer of about 62-111 amino acid residues. Secondary Structure: 6% helical (1 helices; 3 residues)36% beta sheet (5 strands; 18 residues). BTC was originally identified as a growth-promoting factor in mouse pancreatic B Beta-cell carcinoma cell line and has since been identified in humans. It plays a role in the growth and development of the neonate and/or mammary gland function. Betacellulin is a potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.
- Versandbedingungen:
- Blue Ice