Recombinant Human TNFRSF9/4-1BB/CD137 Protein

Größe

£127.00

SKU:: RP01698
Zusätzliche Namen:: 4-1BB|CD137|CDw137|ILA|TNFRSF9
Molekulargewicht:: 25-35 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Leu 24 - Gln 186(Q07011-1)
Formulierung:: Recombinant Human Leukemia inhibitory factor/LIF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu24-Gln186) of human TNFRSF9/4-1BB/CD137 (Accession #NP_002300.1) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Uniprot:: Q07011
Synonyme:: 4-1BB;4-1BB ligand receptor;CD137;CD137 antigen;CDw137;homolog of mouse 4-1BB;ILA;induced by lymphocyte activation (ILA);interleukin-activated receptor, homolog of mouse Ly63;receptor protein 4-1BB;T cell antigen ILA;T-cell antigen 4-1BB homolog;T-cell antigen ILA;tumor necrosis factor receptor superfamily member 9
Weitere Details:: CD137 (also known as 4-1BB) is a surface co-stimulatory glycoprotein originally described as present on activated T lymphocytes, which belongs to the tumor necrosis factor (TNF) receptor superfamily. It is expressed mainly on activated CD4+ and CD8+ T cells, and binds to a high-affinity ligand (4-1BBL) expressed on several antigen-presenting cells such as macrophages and activated B cells. Upon ligand binding, 4-1BB is associated with the tumor necrosis factor receptor-associated factors (TRAFs), the adaptor protein which mediates downstream signaling events including the activation of NF-kappaB and cytokine production. 4-1BB signaling either by binding to 4-1BBL or by antibody ligation delivers signals for T-cell activation and growth, as well as monocyte proliferation and B-cell survival, and plays an important role in the amplification of T cell-mediated immune responses.

Versandbedingungen:: Blue Ice