RP01686
Recombinant Human IL-9 Protein

Größe
£145.00
- SKU:
- RP01686
- Zusätzliche Namen:
- HP40|IL-9; IL9|P40
- Molekulargewicht:
- Approximately 35 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Gln19-Ile144
- Formulierung:
- Recombinant Human IL-9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-Ile144) of human IL9 (Accession #NP_000581.1) fused with and a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
- Uniprot:
- P15248
- Synonyme:
- cytokine P40;homolog of mouse T cell and mast cell growth factor 40;HP40;IL-9;interleukin-9;P40;p40 cytokine;p40 T-cell and mast cell growth factor;T-cell growth factor p40
- Weitere Details:
- Interleukin 9, also known as IL-9, is a cytokine (cell signaling molecule) belonging to the group of interleukins. IL-9 is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL-9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.
- Versandbedingungen:
- Blue Ice



