Recombinant Mouse EGF Protein

Größe

£127.00

SKU:: RP01684
Zusätzliche Namen:: beta-urogastrone, EGF, epidermal growth factor (beta-urogastrone), epidermal growth factor, HOMG4, pro-epidermal growth factor, URG, Urogastrone
Molekulargewicht:: 11 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Asn977-Arg1029
Formulierung:: Recombinant Mouse EGF Protein is produced by Pichia expression system. The target protein is expressed with sequence (Asn977-Arg1029) of mouse EGF (Accession #NP_034243.2) fused with no additional amino acid.
Spezies:: Mouse
Sequenz:: NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Uniprot:: P01132
Synonyme:: AI790464;pro-epidermal growth factor;Pro-epidermal growth factor precursor (EGF)
Weitere Details:: EGF is the founding member of the EGF-family of proteins. Members of this protein family have highly similar structural and functional characteristics. EGF contains 9 EGF-like domains and 9 LDL-receptor class B repeats. Human EGF is a 6045-Da protein with 53 amino acid residues and three intramolecular disulfide bonds. As a low-molecular-weight polypeptide, EGF was first purified from the mouse submandibular gland, but since then it was found in many human tissues including submandibular gland, parotid gland.