Recombinant Human IHH Protein

Größe

£163.00

SKU:: RP01672
Zusätzliche Namen:: BDA1|HHG2; IHH
Molekulargewicht:: 20 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Cys28-Gly202(Cys28Ile-Ile) (N-Met)
Formulierung:: Recombinant Human IHH Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys28-Gly202(Cys28Ile-Ile) (N-Met) ) of human IHH (Accession #NP_002172.2) fused with no additional amino acid.
Spezies:: Human
Sequenz:: CGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG
Uniprot:: Q14623
Synonyme:: BDA1;HHG-2;HHG2;Indian hedgehog homolog;indian hedgehog protein
Weitere Details:: By Similarity2 Publications Indian hedgehog protein N-product The dually lipidated indian hedgehog protein N-product is a morphogen which is essential for a variety of patterning events during development.