Recombinant Rat Cystatin-C/CST3 Protein

Größe

£163.00

SKU:: RP01668
Zusätzliche Namen:: CYSC; Cystatin-C; CST3
Molekulargewicht:: 18-25 kDa
Reinheit:: ≥90%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Gly 21-Ala140
Formulierung:: Recombinant Rat Cystatin-C/CST3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly 21-Ala140) of rat Cystatin-C/CST3 (Accession #NP_036969.1) fused with and a 6xHis tag at the C-terminus.
Spezies:: Rat
Sequenz:: GTSRPPPRLLGAPQEADASEEGVQRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGINYYLDVEMGRTTCTKSQTNLTNCPFHDQPHLMRKALCSFQIYSVPWKGTHTLTKSSCKNA
Uniprot:: P14841
Synonyme:: CYSC;Cystatin C (cysteine proteinase inhibitor);cystatin-3;cystatin-C
Weitere Details:: Cystatin C, also known as Cystatin-3 (CST3) is a secreted type 2 cysteine protease inhibitor synthesized in all nucleated cells, has been proposed as a replacement for serum creatinine for the assessment of renal function, particularly to detect small reductions in glomerular filtration rate.