Recombinant Mouse TFPI Protein

Größe

£163.00

SKU:: RP01667
Zusätzliche Namen:: A630013F22Rik; TFPI|EPI|LACI
Molekulargewicht:: 45-55 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Leu 29-Asn306
Formulierung:: Recombinant Mouse TFPI Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu 29-Asn306) of mouse TFPI (Accession #NP_035706.1) fused with and a 6xHis tag at the C-terminus.
Spezies:: Mouse
Sequenz:: LSEEADDTDSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPVHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRDYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTGLIKNKSKGVVKIQRRKAPFVKVVYESIN
Uniprot:: O54819
Synonyme:: A630013F22Rik;AW552122;EPI;extrinsic pathway inhibitor;LACI;lipoprotein-associated coagulation inhibitor;tissue factor pathway inhibitor
Weitere Details:: Tissue factor pathway inhibitor (TFPI) is the natural inhibitor of TF coagulant and signaling activities. It is a Kunitz-type serine proteinase inhibitor that down-regulates tissue factor-initiated blood coagulation.