Recombinant Human S100-A8 Protein

Größe

£133.00

SKU:: RP01629LQ
Zusätzliche Namen:: 60B8AG, CAGA, CFAG, CGLA, CP-10, L1Ag, MA387, MIF, MRP8, NIF, P8,S100A8,CAGA,CFAG,CGLA,CP-10,L1Ag,MA387,MIF,MRP8,NIF,P8
Molekulargewicht:: 15-20 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -70[o]C Aliquot. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Met1-Glu93
Formulierung:: Recombinant Human S100-A8 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu93) of human S100-A8 (Accession #NP_002955.2) fused with a Flag tag at the C-terminus.
Spezies:: Human
Sequenz:: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Uniprot:: P05109
Synonyme:: 60B8AG;CAGA;calgranulin A;Calgranulin-A;calprotectin L1L subunit;CFAG;CGLA;CP-10;cystic fibrosis antigen;L1Ag;leukocyte L1 complex light chain;MA387;MIF;migration inhibitory factor-related protein 8;MRP8;NIF;P8;protein S100-A8;S100 calcium-binding protein A8;S100-A8;urinary stone protein band A
Weitere Details:: This protein is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Dry Ice