Recombinant Human IL-22 Protein

Größe

£145.00

SKU:: RP01616
Zusätzliche Namen:: Cytokine Zcyto18|IL-22|IL-D110|IL-TIF|Interleukin-22|TIFa|TIFIL-23|ZCYTO18,IL22
Molekulargewicht:: 17-35 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Ala34-Ile179
Formulierung:: Recombinant Human IL-22 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala34-Ile179) of human IL-22 (Accession #NP_065386.1) fused with and a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Uniprot:: Q9GZX6
Synonyme:: cytokine Zcyto18;IL-10-related T-cell-derived inducible factor;IL-10-related T-cell-derived-inducible factor;IL-21;IL-22;IL-D110;IL-TIF;ILTIF;interleukin-22;TIFa;TIFIL-23;zcyto18
Weitere Details:: The cytokine interleukin-22 (IL-22) is a critical regulator of epithelial homeostasis. It has been implicated in multiple aspects of epithelial barrier function, including regulation of epithelial cell growth and permeability, production of mucus and antimicrobial proteins (AMPs), and complement production.