Recombinant Mouse PPIase A/PPIA Protein

Größe

£127.00

SKU:: RP01609LQ
Zusätzliche Namen:: CYPA,CYPH,HEL-S-69p,PPIA
Molekulargewicht:: 15-20 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -70[o]C Aliquot. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Met1-Leu164
Formulierung:: Recombinant Mouse PPIase A/PPIA Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Leu164) of mouse PPIase A/PPIA (Accession #NP_032933.1) fused with a 6xHis tag at the C-terminus.
Spezies:: Mouse
Sequenz:: MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL
Uniprot:: P17742
Synonyme:: Cp;Cphn;Cy;cyclophilin A;cyclosporin A-binding protein;CyP-1;CyP-18;CypA;peptidyl-prolyl cis-trans isomerase A;PPIase A;rotamase A;SP18
Weitere Details:: This protein is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.