RP01606
Recombinant Monkeypox virus D6L Protein
Größe
£127.00
- SKU:
- RP01606
- Zusätzliche Namen:
- COP-009|D6L|IL-18 binding protein
- Molekulargewicht:
- 15-20 kDa
- Spezies-Reaktivität:
- Virus
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Val21-Lys126
- Formulierung:
- Recombinant Monkeypox virus D6L Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val21-Lys126) of monkeypox virus D6L (Accession #Q5QC89) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Virus
- Sequenz:
- VETKCPNLAIVTSSGEFHCSGCVERMPGFSYMYWLANDMKSDEDTKFIEHLGDGIKEDETVRTTDGGITTLRKVLHVTDTNKFAHYRFTCVLITLDGVSKKNIWLK
- Uniprot:
- Q5QC89
- Synonyme:
- Interleukin-18-binding protein;MPXV_gp007
- Versandbedingungen:
- Blue Ice