RP01593
Recombinant Monkeypox virus A30L Protein
Größe
£127.00
- SKU:
- RP01593
- Zusätzliche Namen:
- Envelope protein A28 homolog, Protein A30,A30L
- Molekulargewicht:
- 20-35 kDa
- Spezies-Reaktivität:
- Virus
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Gln22-Leu146
- Formulierung:
- Recombinant Monkeypox virus A30L Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln22-Leu146) of monkeypox virus A30L (Accession #NP_536567.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Virus
- Sequenz:
- QSYSIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMRQCIDFTFSDVINIDIYNPCIAPNINNTECQFLKSVL
- Uniprot:
- Q8V4U9
- Synonyme:
- Envelope protein A28 homolog;MPXV_gp134;Protein A30
- Versandbedingungen:
- Blue Ice