RP01588LQ
Recombinant Mouse MUP-1 Protein
Größe
£127.00
- SKU:
- RP01588LQ
- Zusätzliche Namen:
- Major urinary protein 1, Mup7, Up-1, Ltn-1, Mup-1, Mup-a, Mup10, Lvtn-1,MUP1,Major urinary protein 1, Mup7, Up-1, Ltn-1, Mup-1, Mup-a, Mup10, Lvtn-1,MUP1
- Molekulargewicht:
- 20-24 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Glu19-Glu180
- Formulierung:
- Recombinant Mouse MUP-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu19-Glu180) of mouse MUP-1 (Accession #NP_001186924.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Mouse
- Sequenz:
- EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEKHGILRENIIDLSNANRCLQARE
- Uniprot:
- P11588
- Synonyme:
- Gm2024;Ltn;Ltn-1;Lvt;Lvtn-1;major urinary protein 1;major urinary protein 10;major urinary protein 12;major urinary protein 7;Mup;MUP 1;Mup-;Mup-1;Mup-a;Mup1;Mup10;Mup7;Up-;Up-1
- Weitere Details:
- Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.
- Versandbedingungen:
- Dry Ice