Recombinant Mouse Ep-CAM/TROP-1/CD326 Protein

Größe

£127.00

SKU:: RP01570
Zusätzliche Namen:: 17-1A, 323/A3, ACSTD1,CD326,EGP-2, EGP314, EGP40, EpCAM, MOC31, TACST-1, TACSTD1,TROP1,EpCAM
Molekulargewicht:: 35-40 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Gln24-Thr266
Formulierung:: Recombinant Mouse Ep-CAM/TROP-1/CD326 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Thr266) of mouse Ep-CAM/TROP-1/CD326 (Accession #NP_032558.2) fused with a 6xHis tag at the C-terminus.
Spezies:: Mouse
Sequenz:: QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT
Uniprot:: Q99JW5
Synonyme:: CD326;EGP;EGP-;EGP-2;Egp31;Egp314;Ep-C;Ep-CAM;EpC;EpCA;EpCAM1;epithelial cell adhesion molecule;epithelial glycoprotein 314;GA733-;GA733-2;gp4;gp40;Ly7;Ly74;lymphocyte antigen 74;mEGP314;panepithelial glycoprotein 314;protein 289A;Tacsd1;Tacst;Tacstd1;TR;Trop-1 protein;TROP1;tumor-associated calcium signal transducer 1
Weitere Details:: Epithelial Cellular Adhesion Molecule (Ep-CAM), also known as EGP314, mEGP314, Protein 289A, Tumor-associated calcium signal transducer 1, CD326, belongs to the EPCAM family. Its ' monomer subunit structureinteracts with phosphorylated CLDN7. Ep-CAM may act as a physical homophilic interaction molecule betweenintestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providingimmunological barrier as a first line of defense against mucosal infection. It plays a role in embryonic stem cellsproliferation and differentiation. It also up-regulates the expression of FABP5, MYC and cyclins A and E. Thepost-translational modification glycosylation at Asn-198 is crucial for protein stability.

Versandbedingungen:: Blue Ice