RP01568
Recombinant Rat B7-H1/PD-L1/CD274 Protein
Größe
£133.00
- SKU:
- RP01568
- Zusätzliche Namen:
- Pdcd1lg1, RGD1566211,CD274
- Molekulargewicht:
- 40-50 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ala18-Thr238
- Formulierung:
- Recombinant Rat B7-H1/PD-L1/CD274 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala18-Thr238) of rat B7-H1/PD-L1/CD274 (Accession #NP_001178883.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Rat
- Sequenz:
- AFTITAPKDLYVVEYGSNVTMECRFPVEQKLDLLALVVYWEKEDKEVIQFVEGEEDLKPQHSSFRGRAFLPKDQLLKGNAVLQITDVKLQDAGVYCCMISYGGADYKRITLKVNAPYRKINQRISMDPATSEHELMCQAEGYPEAEVIWTNSDHQSLSGETTVTTSQTEEKLLNVTSVLRVNATANDVFHCTFWRVHSGENHTAELIIPELPVPRLPHNRT
- Uniprot:
- D4AE25
- Synonyme:
- Pdcd1lg1;programmed cell death 1 ligand 1;RGD1566211
- Weitere Details:
- This protein is an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The protein is a type I transmembrane protein that has immunoglobulin V-like and C-like domains. Interaction of this ligand with its receptor inhibits T-cell activation and cytokine production. During infection or inflammation of normal tissue, this interaction is important for preventing autoimmunity by maintaining homeostasis of the immune response. In tumor microenvironments, this interaction provides an immune escape for tumor cells through cytotoxic T-cell inactivation.
- Versandbedingungen:
- Blue Ice