RP01555
Recombinant Mouse CD83 Protein
Größe
£127.00
- SKU:
- RP01555
- Zusätzliche Namen:
- BL11,HB15,CD83
- Molekulargewicht:
- 25-35 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Met22-Ala134
- Formulierung:
- Recombinant Mouse CD83 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met22-Ala134) of mouse CD83 (Accession #NP_033986.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Mouse
- Sequenz:
- MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRA
- Uniprot:
- O88324
- Synonyme:
- CD83 antigen;mCD83
- Weitere Details:
- Mouse CD83 is a 30-35 kDa member of the Siglec (or sialic-acid-binding immunoglobulin-like lectin) family of transmembrane proteins.CD83 is considered as a marker of mature dendritic cells as well as an adhesion receptor that binds to resting monocytes and a subset of activated CD8+ T cells. In certain conditions, CD83 tended to dimerize or even multimerize through its aberrant intermolecular disulfide bonds. The injection of CD83-Ig can significantly enhaunce the rate of tumor growth and inhibit the T cell growth.
- Versandbedingungen:
- Blue Ice