RP01553
Recombinant Mouse Fc-epsilon RI-alpha/FCER1A Protein
Größe
£145.00
- SKU:
- RP01553
- Zusätzliche Namen:
- FCE1A,FcERI,FCER1A
- Molekulargewicht:
- 65-75 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ala24-Gln204
- Formulierung:
- Recombinant Mouse Fc-epsilon RI-alpha/FCER1A Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Gln204) of mouse Fc-epsilon RI-alpha/FCER1A (Accession #NP_034314.2) fused with a hFc tag at the C-terminus.
- Spezies:
- Mouse
- Sequenz:
- ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQ
- Uniprot:
- P20489
- Synonyme:
- fc-epsilon RI-alpha;FcE;Fce1;Fce1a;fcepsilonri;FcERI;Fcr-;Fcr-5;high affinity immunoglobulin epsilon receptor subunit alpha;igE Fc receptor subunit alpha
- Weitere Details:
- FCER1A is the alpha subunit of the immunoglobulin epsilon receptor (IgE receptor). IgE receptor is a high affinity IgE receptor which plays a central role in allergic disease, coupling allergen and mast cell to initiate the inflammatory and immediate hypersensitivity responses that are characteristic of disorders such as hay fever and asthma. The allergic response occurs when 2 or more IgE receptors are crosslinked via IgE molecules that in turn are bound to an allergen (antigen) molecule. A perturbation occurs that brings about the release of histamine and proteases from the granules in the cytoplasm of the mast cell and leads to the synthesis of prostaglandins and leukotrienes--potent effectors of the hypersensitivity response. IgE receptor is comprised of an alpha subunit(FcERI), a beta subunit, and two gamma subunits. FcERI is glycosylated and contains 2 Ig-like (immunoglobulin-like) domains.
- Versandbedingungen:
- Blue Ice