RP01546
Recombinant Monkeypox virus A29 Protein
Größe
£127.00
- SKU:
- RP01546
- Zusätzliche Namen:
- A29L,A29,A29L,A29L,A29,A29L
- Molekulargewicht:
- 15-20 kDa
- Spezies-Reaktivität:
- Virus
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Met1-Glu110
- Formulierung:
- Recombinant Monkeypox virus A29 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu110) of A29 (Accession #URK20577.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Virus
- Sequenz:
- MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRHPYE
- Uniprot:
- Q77HM6
- Synonyme:
- IMV surface fusion protein;MPXV_gp133
- Versandbedingungen:
- Blue Ice