Recombinant Monkeypox virus L1R Protein

Größe

£145.00

SKU:: RP01544
Zusätzliche Namen:: L1R,L1R
Molekulargewicht:: 15-20 kDa
Spezies-Reaktivität:: Virus
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Met1-Lys152
Formulierung:: Recombinant Monkeypox virus L1R Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Lys152) of L1R (Accession #URK20522.1) fused with a 6xHis tag at the C-terminus.
Spezies:: Virus
Sequenz:: MDHNQYLLTMFFADDDSFFKYFASQDDESSLSDILQITQYLDFLLLLLIQSKNKLEAVGHCYESLSEEYRQLTKFTDSQDFKKLFNKVPIVTDGRVKLNKGYLFDFVISLMRFKKESALATTAIDPVRYIDPRRDIAFSNVMDILKSNKVEK
Uniprot:: Q8V4Z7
Synonyme:: IMV membrane protein J1;MPXV_gp080