Recombinant Mouse IL-18BP Protein

Größe

£127.00

SKU:: RP01531
Zusätzliche Namen:: MC54L,Igifbp,IL-18BP,IL18BP
Molekulargewicht:: 30-50 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Thr29-Ala193
Formulierung:: Recombinant Mouse IL-18BP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr29-Ala193) of mouse IL-18BP (Accession #NP_034661.1) fused with a 6xHis tag at the C-terminus.
Spezies:: Mouse
Sequenz:: TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA
Uniprot:: Q9Z0M9
Synonyme:: Igi;Igifbp;IL-1;IL-18BP;interferon gamma-inducing factor-binding protein;interleukin-18-binding protein;MC54;MC54L
Weitere Details:: Interleukin-18-binding protein (IL-18BP) is a constitutively expressed and secreted protein. IL-18BP is a cytokine receptor that belongs to the interleukin 1 receptor family. This receptor specifically binds interleukin 18 (IL18) and is essential for IL18 mediated signal transduction. IFN-alpha and IL12 are reported to induce the expression of this receptor in NK and T cells. This gene along with four other members of the interleukin 1 receptor family, including IL1R2, IL1R1, ILRL2 (IL-1Rrp2), and IL1RL1 (T1/ST2), form a gene cluster on chromosome 2q. The adjacently located family members IL18 Receptor 1 (IL18R1) and IL18 receptor accessory protein (IL18RAP) may also be important in the development of asthma and atopy. IL-18 binding protein (IL-18BP) was only moderately elevated, resulting in a high level of biologically active free IL-18 in HPS. A severe IL-18/IL-18BP imbalance results in Th-1 lymphocyte and macrophage activation, which escapes control by NK-cell cytotoxicity and may allow for secondary HPS in patients with underlying diseases.

Versandbedingungen:: Blue Ice