Recombinant Mouse NKp46/NCR1/CD335 Protein

Größe

£133.00

SKU:: RP01525
Zusätzliche Namen:: Ly94,NKp46,Ncr1
Molekulargewicht:: 70-80 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Gln17-Asn255
Formulierung:: Recombinant Mouse NKp46/NCR1/CD335 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln17-Asn255) of mouse NCR1/CD335 (Accession #NP_034876.2) fused with a raFc tag at the C-terminus.
Spezies:: Mouse
Sequenz:: QRINTEKETLPKPIIWAKPSIMVTNGNSVNIWCQGAQSASEYQLYFEGSFFALERPKPSRSMNKVRFFISQMTSHTAGIYTCFYQSGELWSKSSNPLKLVVTGLYDTPNLWVYPRPEVTLGENVTFFCQLKTATSKFFLLKERGSNHIQNKYGNIQAEFPMGPVTRAHRGTYRCFGSYNDYAWSFPSEPVTLLITGGVENSSLAPTDPTSSLDYWEFDLSTNESGLQKDSAFWDHTTQN
Uniprot:: Q8C567
Synonyme:: activating receptor 1;Ly9;Ly94;lymphocyte antigen 94;mAR-1;MAR1 (mouse activating receptor 1);mNKp46;natural cytotoxicity triggering receptor 1;natural killer cell p46-related protein;NK-p46;NKp;NKp46
Weitere Details:: NCR1, also known as NK-p46 and CD335, is a natural cytotoxicity receptor(NCR). NCRs are type I transmembrane proteins with 1-2 extracellular immunoglobulin domains, a transmembrane domain containing a positively charged amino acid residue, and a short cytoplasmic tail. All are expressed almost exclusively by NK cells and play a major role in triggering NK-mediated killing of most tumor cell lines. NKp46 has two extracellular Ig-like domains followed by a ~40 residue stalk region, a type I transmembrane domain, and a short cytoplasmic tail. NKp46 has been implicated in NK cell-mediated lysis of several autologous tumor cells, pathogen-infected cell lines, and mononuclear phagocytes infected with an intracellular bacterium.

Versandbedingungen:: Blue Ice