RP01500
Recombinant Mouse CD5 Protein
Größe
£133.00
- SKU:
- RP01500
- Zusätzliche Namen:
- LEU1,T1,CD5
- Molekulargewicht:
- 50-60 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ser25-Pro371
- Formulierung:
- Recombinant Mouse CD5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser25-Pro371) of mouse CD5/Lyt1 (Accession #NP_031676.3) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Mouse
- Sequenz:
- SGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPNP
- Uniprot:
- P13379
- Synonyme:
- Ly;Ly-;Ly-1;Ly-12;Ly-A;lymphocyte antigen 1;Lyt-;Lyt-1;T-cell surface glycoprotein CD5
- Weitere Details:
- CD5, also known as Leu-1, Ly-1, and T1, is a 67 kDa transmembrane glycoprotein in the scavenger receptor superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation.
- Versandbedingungen:
- Blue Ice