Recombinant Human Glutathione S-transferase omega-1/GSTO-1/SPG-R Protein

Größe

£113.05

War £133.00

SKU:: RP01494LQ
Zusätzliche Namen:: GSTO 1-1, GSTTLp28, HEL-S-21, P28, SPG-R,GSTO1, GSTO 1-1, GSTO1-1, glutathione S-transferase omega-1,GSTTLp28,HEL-S-21,P28,SPG-R,GSTO1-1
Molekulargewicht:: 30-35 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -70[o]C Aliquot. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Ser2-Leu241
Formulierung:: Recombinant Human Glutathione S-transferase omega-1/GSTO-1/SPG-R Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser2-Leu241) of human GSTO1 (Accession #NP_004823.1) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: SGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Uniprot:: P78417
Synonyme:: epididymis secretory protein Li 21;glutathione S-transferase omega 1-1;glutathione S-transferase omega-1;glutathione-dependent dehydroascorbate reductase;glutathione-S-transferase like;GSTO 1-1;GSTTLp28;HEL-S-21;MMA(V) reductase;monomethylarsonic acid reductase;P28;S-(Phenacyl)glutathione reductase;SPG-R
Weitere Details:: Exhibits glutathione-dependent thiol transferase and dehydroascorbate reductase activities. Has S-(phenacyl)glutathione reductase activity. Has also glutathione S-transferase activity. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsonic acid (MMA) and dimethylarsonic acid.

Versandbedingungen:: Dry Ice