RP01490
Recombinant Mouse MFG-E8 Protein

Größe
£181.00
- SKU:
- RP01490
- Zusätzliche Namen:
- P47,MP47,Mfgm,SED1,MFG-E8,AA408458,AI325141,lactadherin,MFGE8
- Molekulargewicht:
- 60-65 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ala23-Cys463
- Formulierung:
- Recombinant Mouse MFG-E8 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala23-Cys463) of mouse MFGE8/BA46 (Accession #NM_008594.2) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Mouse
- Sequenz:
- ASGDFCDSSLCLNGGTCLTGQDNDIYCLCPEGFTGLVCNETERGPCSPNPCYNDAKCLVTLDTQRGDIFTEYICQCPVGYSGIHCETETNYYNLDGEYMFTTAVPNTAVPTPAPTPDLSNNLASRCSTQLGMEGGAIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASNYDSKPWIQVNLLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRKFEFIQDESGGDKEFLGNLDNNSLKVNMFNPTLEAQYIKLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQMSASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAHSDDGVQWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRLELLGC
- Uniprot:
- P21956-1
- Synonyme:
- AA408458;AI325141;EGF/factor VIII;lacta;lactadherin;MFG-E8;Mfgm;milk fat globule glycoprotein;Milk fat globule-EGF factor 8;milk fat globule-EGF factor 8 protein;MP47;P47;SED;SED1;sperm surface protein SP47
- Weitere Details:
- MFG-E8, also known as lactadherin and MFGE8, contains 1 EGF-like domain and 2 F5/8 type C domains. It also contains phosphatidylserine (PS) binding domain, as well as an Arginine-Glycine-Aspartic acid motif, which enables the binding to integrins. It binds PS, which is exposed on the surface of apoptotic cells. MFG-E8 is expressed in mammary epithelial cell surfaces and aortic media. Overexpression of MFG-E8 can be found in several carcinomas. MFG-E8 has opsonization of the apoptotic cells and binding to integrins on the surface of phagocytic cells. It also mediates the engulfment of the dead cell. MFG-E8 plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. It promotes VEGF-dependent neovascularization and contributes to the phagocytic removal of apoptotic cells in many tissues. It also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner.
- Versandbedingungen:
- Blue Ice



