Recombinant Human LILRA1/LIR-6/CD85i Protein

Größe

£145.00

SKU:: RP01457
Zusätzliche Namen:: LILRA1,CD85I,LIR-6,LIR6
Molekulargewicht:: 70-90 kDa
Reinheit:: ≥90%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Pro17-Asn461
Formulierung:: Recombinant Human LILRA1/LIR-6/CD85i Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro17-Asn461) of human LILRA1/CD85i/LIR-6 (Accession #NP_006854.1) fused with a 6xHis, Avi tag at the C-terminus.
Spezies:: Human
Sequenz:: PRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVSGAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVEN
Uniprot:: O75019
Synonyme:: CD85 antigen-like family member I;CD85I;leucocyte Ig-like receptor A1;leukocyte immunoglobulin-like receptor 6;leukocyte immunoglobulin-like receptor subfamily A member 1;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 1;LIR-6;LIR6
Weitere Details:: Leukocyte immunoglobulin-like receptors (LILRs) are inhibitory, stimulatory or soluble receptors encoded within the leukocyte receptor complex. Some LILRs are extensively polymorphic, and exhibit evidence for balancing selection and association with disease susceptibility. LILRA1 (LIR-6) can recognize MHC (major histocompatibility complex) class I or class I-like molecules, and high levels of sequence similarity among LILRA1, LILRA2 (ILT1), LILRA3 (ILT6) and LILRB1/B2.

Versandbedingungen:: Blue Ice