RP01432
Recombinant Human IFN-alpha 2 Protein
Größe
£107.00
- SKU:
- RP01432
- Zusätzliche Namen:
- IFNA2, IFN-alphaA, IFNA, IFNA2B, INFA2, interferon alpha-2,Interferon alpha 2 (IFN-A Alpha2) ,IFN-alphaA,IFNA,IFNA2B,INFA2
- Molekulargewicht:
- 20-23 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Cys24-Glu188
- Formulierung:
- Recombinant Human IFN-alpha 2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys24-Glu188) of human Interferon alpha 2/IFNA2 (Accession #NP_000596.2) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
- Uniprot:
- P01563
- Synonyme:
- alpha-2a interferon;IFN-alpha-2;IFN-alphaA;IFNA;IFNA2B;interferon alpha 2a;interferon alpha 2b;interferon alpha A;interferon alpha-2;Interferon alpha-A;leIF A
- Weitere Details:
- IFNA2 (Interferon Alpha 2) is a Protein Coding gene. This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Type I Interferons (IFNs) are well-known cytokines that exert antiviral activity, antitumor activity, and immunomodulatory effects. Interferon tau (IFNT), a type I IFN similar to alpha IFNs (IFNA), is the pregnancy recognition signal produced by the ruminant conceptus. Among the IFN-A Alpha genes, a total of 28 different sequence variants have been described. The three principal subtypes of IFNA Alpha-2 are designated A Alpha-2a, A Alpha-2b, and A Alpha-2c. IFNA Alpha-2b is being the predominant allele while IFNA Alpha-2a is less predominant and IFNA Alpha-2c only a minor allelic variant.
- Versandbedingungen:
- Blue Ice