Recombinant Human Ephrin-A1/EFNA1 Protein

Größe

£133.00

SKU:: RP01425
Zusätzliche Namen:: B61, ECKLG, EFL1, EPLG1, LERK-1, LERK1, TNFAIP4,EFNA1,ECKLG,EFL1,EPLG1,LERK-1,LERK1,TNFAIP4,ephrin-A1
Molekulargewicht:: 55-70 kDa
Reinheit:: ≥90%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Asp19-Ser182
Formulierung:: Recombinant Human Ephrin-A1/EFNA1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp19-Ser182) of human Ephrin-A1/EFNA1 (Accession #NP_004419.2) fused with a hFc tag at the C-terminus.
Spezies:: Human
Sequenz:: DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS
Uniprot:: P20827
Synonyme:: B61;ECKLG;EFL1;eph-related receptor tyrosine kinase ligand 1;ephrin-A1;epididymis secretory sperm binding protein;EPLG1;gastric cancer metastasis associated long noncoding RNA;GMAN;immediate early response protein B61;LERK-1;LERK1;ligand of eph-related kinase 1;TNF alpha-induced protein 4;TNFAIP4;Tumor necrosis factor alpha-induced protein 4;tumor necrosis factor, alpha-induced protein 4
Weitere Details:: EPH-related receptor tyrosine kinase ligand 1 (abbreviated as Ephrin-A1) also known as ligand of eph-related kinase 1 or EFNA1, is a member of the ephrin (EPH) family. The Eph family receptor interacting proteins (ephrins) are a family of proteins that serve as the ligands of the Eph receptor, which compose the largest known subfamily of receptor protein-tyrosine kinases (RTKs). Ephrin-A1/EFNA1 and its Eph family of receptor tyrosine kinases are expressed by cells of the SVZ. Ephrin subclasses are further distinguished by their mode of attachment to the plasma membrane: ephrin-A ligands bind EphA receptors and are anchored to the plasma membrane via a glycosylphosphatidylinositol (GPI) linkage, whereas ephrin-B ligands bind EphB receptors and are anchored via a transmembrane domain. An exception is the EphA4 receptor, which binds both subclasses of ephrins. Ephrin-A1 and one of its receptor EphA2 were expressed in xenograft endothelial cells and also tumor cells and play a role in human cancers, at least in part by influencing tumor neovascularization.

Versandbedingungen:: Blue Ice