RP01424
Recombinant Cynomolgus IL-2RG/CD132 Protein
Größe
£127.00
- SKU:
- RP01424
- Zusätzliche Namen:
- IL2RG,CD132,CIDX,IMD4,P64,SCIDX,SCIDX1,gammaC,IL2RG
- Molekulargewicht:
- 70-100 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Leu23-Asn254
- Formulierung:
- Recombinant Cynomolgus IL-2RG/CD132 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu23-Asn254) of cynomolgus (rhesus macaque) IL-2 R gamma/CD132 (Accession #NP_001030606.1) fused with a Fc, Avi tag at the C-terminus.
- Spezies:
- Non-human Primate
- Sequenz:
- LNTTILTPNGNEDATTDFFLTSMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQEKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLRKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNSSKEN
- Uniprot:
- Q38JL2
- Synonyme:
- cytokine receptor common subunit gamma;EGK_20620;interleukin 2 receptor, gamma (severe combined immunodeficiency);membrane receptor Il2rg
- Weitere Details:
- The common gamma chain (G Gammac) (or CD132), also known as interleukin-2 receptor subunit gamma or IL2RG, is a member of the type I cytokine receptor family expressed on most lymphocyte (white blood cell) populations, and its gene is found on the X-chromosome of mammals. The common gamma chain (G Gammac) (or IL2RG), is a cytokine receptor subunit that is common to the receptor complexes for at least six different interleukin receptors: IL-2, IL-4, IL-7, IL-9, IL-15, and the interleukin-21 receptor. It is a component of multiple cytokine receptors that are essential for lymphocyte development and function. X-linked severe combined immunodeficiency (X-SCID) is a rare and potentially fatal disease caused by mutations of IL2RG, the gene encoding IL2RG. IL2RG was demonstrated to be a component of the IL-4 receptor based on chemical cross-linking data, the ability of IL2RG to augment IL-4 binding affinity. The observation that IL-2R gamma is a functional component of the IL-4 receptor, together with the finding that IL-2R gamma associates with the IL-7 receptor, begins to elucidate why a deficiency of this common gamma chain (gamma c) has a profound effect on lymphoid function and development, as seen in X-linked severe combined immunodeficiency.
- Versandbedingungen:
- Blue Ice