RP01415
Recombinant Mouse Complement C3 Protein

Größe
£288.00
- SKU:
- RP01415
- Zusätzliche Namen:
- C3,AHUS5,ARMD9,ASP,C3a,C3b,CPAMD1,HEL-S-62p,complement C3,C3 / C3a
- Molekulargewicht:
- 15 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ser671-Arg748
- Formulierung:
- Recombinant Mouse Complement C3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser671-Arg748) of mouse Complement component 3 (Accession #NP_033908.2) fused with a 6xHis, Avi tag at the C-terminus.
- Spezies:
- Mouse
- Sequenz:
- SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR
- Uniprot:
- P01027-1
- Synonyme:
- acylation stimulating protein;AI255234;ASP;complement C3;complement component 3d;complement factor 3;HSE-MSF;Plp
- Weitere Details:
- C3 is the major complement component serum. It is mainly synthesized by macrophages and liver. C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. It is cleaved into two fragments, C3a and C3b. C3a anaphylatoxin is a mediator of local inflammatory process. In chronic inflammation, acts as a chemoattractant for neutrophils. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes.
- Versandbedingungen:
- Blue Ice

