Recombinant Human TGFR-1/ALK-5 Protein

Größe

£133.00

SKU:: RP01408
Zusätzliche Namen:: TGFBR1,AAT5,ACVRLK4,ALK-5,ALK5,ESS1,LDS1,LDS1A,LDS2A,MSSE,SKR4,TGFR-1,tbetaR-I,TBRI,TBR-i
Molekulargewicht:: 40-55 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Met1-Glu125
Formulierung:: Recombinant Human TGFR-1/ALK-5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu125) of human TGFBR1/ALK5 (Accession #NP_004603.1) fused with a Fc, 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVE
Uniprot:: P36897-1
Synonyme:: AAT5;activin A receptor type II-like kinase, 53kDa;activin A receptor type II-like protein kinase of 53kD;activin receptor-like kinase 5;ACVRLK4;ALK-5;ALK5;ESS1;LDS1;LDS1A;LDS2A;MSSE;mutant transforming growth factor beta receptor I;serine/threonine-protein kinase receptor R4;SKR4;tbetaR-I;TBR-i;TBRI;TGF-beta receptor type-1;TGF-beta type I receptor;TGFR-1;transforming growth factor beta receptor I;transforming growth factor-beta receptor type I
Weitere Details:: Transforming growth factor, beta receptor I, also known as Transforming growth factor-beta receptor type I , Serine / threonine-protein kinase receptor R4, Activin receptor-like kinase 5, SKR4, ALK-5, and TGFBR1, is a single-pass type I membrane protein that belongs to the protein kinase superfamily and TGFB receptor subfamily. TGFBR1 / ALK-5 is found in all tissues examined. It is most abundant in placenta and least abundant in brain and heart. TGF-beta functions as a tumor suppressor by inhibiting the cell cycle in the G1 phase. Administration of TGF-beta is able to protect against mammary tumor development in transgenic mouse models in vivo. Disruption of the TGF-beta/SMAD pathway has been implicated in a variety of human cancers, with the majority of colon and gastric cancers being caused by an inactivating mutation of TGF-beta RII. On ligand binding, TGFBR1 / ALK-5 forms a receptor complex consisting of two type I I and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which auto-phosphorylate, then bind and activate SMAD transcriptional regulators.

Versandbedingungen:: Blue Ice