Recombinant Human Fc epsilon RII/CD23 Protein

Größe

£133.00

SKU:: RP01407
Zusätzliche Namen:: BLAST-2, CD23, CD23A, CLEC4J, FCE2, IGEBF,FCER2, BLAST-2, Fc fragment of IgE receptor II,CD23,CD23A,CLEC4J,FCE2,IGEBF
Molekulargewicht:: 40 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Asp48-Ser321
Formulierung:: Recombinant Human Fc epsilon RII/CD23 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp 48-Ser321) of human CD23/Fc epsilon RII (Accession #NP_001993.2.) fused with a 6xHis tag at the N-terminus.
Spezies:: Human
Sequenz:: DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Uniprot:: P06734
Synonyme:: BLAST-2;C-type lectin domain family 4 member J;C-type lectin domain family 4, member J;CD23;CD23 antigen;CD23A;CLEC4J;Fc epsilon receptor II;Fc fragment of IgE, low affinity II, receptor for (CD23);fc-epsilon-RII;FCE2;IGEBF;immunoglobulin E-binding factor;immunoglobulin epsilon-chain;low affinity immunoglobulin epsilon Fc receptor;lymphocyte IgE receptor
Weitere Details:: Fc fragment of IgE, low affinity II, receptor for (CD23) or CD23 antigen is a member of the cluster of differentiation family. The cluster of differentiation (cluster of designation) (often abbreviated as CD) is a protocol used for the identification and investigation of cell surface molecules present on white blood cells initially but found in almost any kind of cell of the body, providing targets for immunophenotyping of cells. Physiologically, CD molecules can act in numerous ways, often acting as receptors or ligands (the molecule that activates a receptor) important to the cell. A signal cascade is usually initiated, altering the behavior of the cell (see cell signaling). Some CD proteins do not play a role in cell signaling, but have other functions, such as cell adhesion. CD23/FCER2 is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Increased levels of soluble CD23/FCER2 cause the recruitment of non-sensitised B-cells in the presentation of antigen peptides to allergen-specific B-cells, therefore increasing the production of allergen specific IgE. IgE, in turn, is known to upregulate the cellular expression of CD23 and Fc epsilon RI (high-affinity IgE receptor).

Versandbedingungen:: Blue Ice