RP01404
Recombinant Human FGF-3 Protein

Größe
£133.00
- SKU:
- RP01404
- Zusätzliche Namen:
- FGF3,HBGF-3,INT2
- Molekulargewicht:
- Approximately 25 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Asp28-Arg212 (N-Met)
- Formulierung:
- Recombinant Human FGF-3 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Asp28-Arg212 (N-Met) ) of human FGF-3 (Accession #NP_005238.1) fused with no additional amino acid.
- Spezies:
- Human
- Sequenz:
- DAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRR
- Uniprot:
- P11487
- Synonyme:
- FGF-3;fibroblast growth factor 3;fibroblast growth factor 3 (murine mammary tumor virus integration site (v-int-2) oncogene homolog);HBGF-3;heparin-binding growth factor 3;INT-2 proto-oncogene protein;INT2;murine mammary tumor virus integration site 2, mouse;oncogene INT2;proto-oncogene Int-2;V-INT2 murine mammary tumor virus integration site oncogene homolog
- Weitere Details:
- Fibroblast Growth Factor 3 (FGF-3) belongs to the large FGF family which has at least 23 members. All FGF family members are heparin-binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. FGFs are expressed during embryonic development and in restricted adult tissues. They act on cells of mesodermal and neuroectodermal origin to regulate diverse physiologic functions including angiogenesis, cell growth, pattern formation, embryonic development, metabolic regulation, cell migration, neurotrophic effects and tissue repair. Signaling receptors for FGFs are type I transmembrane receptor tyrosine kinases belonging to the Ig superfamily. Four distinct but related classes of FGF receptors, FGF R1, 2, 3, and 4, exist. Through alternative splicing, multiple isoforms for FGF R1, 2 and 3, with distinct ligand recognition profiles, are also generated.
- Versandbedingungen:
- Blue Ice

