RP01403
Recombinant Human CXCL3/GRO-gamma/MIP2-beta Protein
Größe
£133.00
- SKU:
- RP01403
- Zusätzliche Namen:
- CXCL3,CINC-2b,GRO3,GROg,MIP-2b,MIP2B,SCYB3
- Molekulargewicht:
- 10-15 kDa
- Reinheit:
- ≥85%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ala35-Asn107
- Formulierung:
- Recombinant Human CXCL3/GRO-gamma/MIP2-beta Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala35-Asn107) of human CXCL3/GRO gamma (Accession #NP_002081.2) fused with no additional amino acid.
- Spezies:
- Human
- Sequenz:
- ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
- Uniprot:
- P19876
- Synonyme:
- C-X-C motif chemokine 3;chemokine (C-X-C motif) ligand 3;CINC-2b;GRO-gamma;GRO-gamma(1-73);GRO3;GRO3 oncogene;GROg;growth-regulated protein gamma;macrophage inflammatory protein 2-beta;melanoma growth stimulatory activity gamma;MGSA gamma;MIP-2b;MIP2-beta;MIP2B;SCYB3
- Weitere Details:
- CXCL3 is involved in migration, invasion, proliferation and tubule formation of trophoblasts and may play a key role in the pathogenesis of preeclampsia. CXCL3 autocrine/paracrine pathways are involved in the development of prostate cancer by regulating the expression of the target genes that are related to the progression of malignancies. CXCL3 is a novel adipokine that facilitates adipogenesis in an autocrine and/or a paracrine manner through induction of c/ebpb and c/ebpd. CXCL3 and its receptor CXCR2 are overexpressed in prostate cancer cells, prostate epithelial cells and prostate cancer tissues, which may play multiple roles in prostate cancer progression and metastasis.
- Versandbedingungen:
- Blue Ice