RP01402
Recombinant Human CCL21 Protein
Größe
£145.00
- SKU:
- RP01402
- Zusätzliche Namen:
- CCL21,6Ckine,CKb9,ECL,SCYA21,SLC,TCA4
- Molekulargewicht:
- 16-17 kDa
- Reinheit:
- ≥85%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ser24-Pro134
- Formulierung:
- Recombinant Human CCL21 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser24-Pro134) of human CCL21/6Ckine (Accession #NP_002980.1) fused with no additional amino acid.
- Spezies:
- Human
- Sequenz:
- SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
- Uniprot:
- O00585
- Synonyme:
- 6Ckine;beta chemokine exodus-2;Beta-chemokine exodus-2;C-C motif chemokine 21;chemokine (C-C motif) ligand 21;CKb9;ECL;Efficient Chemoattractant for Lymphocytes;SCYA21;secondary lymphoid tissue chemokine;Secondary lymphoid-tissue chemokine;SLC;small inducible cytokine subfamily A (Cys-Cys), member 21;Small-inducible cytokine A21;TCA4
- Weitere Details:
- Chemokines are a family of small chemotactic cytokines, or proteins secreted by cells. Chemokines share the same structure similarities such as small size, and the presence of four cysteine residues in conserved locations in order to form their 3-dimensional shape. Some of the chemokines are considered pro-inflammatory which can be induced to recruit cells of the immune system to a site of infection during an immune response, while others are considered homeostatic and are implied in controlling the migration of cells during normal processes of tissue maintenance and development. There are four members of the chemokine family: C-C kemokines, C kemokines, CXC kemokines and CX3C kemokines. The C-C kemokines have two cysteines nearby the amino terminus. There have been at least 27 distinct members of this subgroup reported for mammals, called C-C chemokine ligands-1 to 28. Chemokine ligand 21(CCL21), also known as 6Ckine, exodus-2, and secondary lymphoid-tissue chemokine(SLC), is a small cytokine belonging to the C-C chemokine family. CCL21 takes its name 6Ckine for its consititutively six conserved cysteine residues but not four cysteines typical to chemokines. CCL21 has function in ininducing vigorous calcium migrations and chemotactic responses.
- Versandbedingungen:
- Blue Ice