RP01394
Recombinant Mouse Fc-gamma RIV/FCGR3A/CD16a Protein
Größe
£133.00
- SKU:
- RP01394
- Zusätzliche Namen:
- Fc gamma RIV,CD16-2,Fcgr4,FCGR4,mouse igg,FcgR4
- Molekulargewicht:
- 35-40 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Gly21-Gln203
- Formulierung:
- Recombinant Mouse Fc-gamma RIV/FCGR3A/CD16a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly21-Gln 203) of mouse Fc gamma RIV/CD16-2 (Accession #NP_653142.2) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Mouse
- Sequenz:
- GLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQ
- Uniprot:
- A0A0B4J1G0
- Synonyme:
- 4833442P21Rik;CD16-2;Fc fragment of IgG, low affinity IIIa, receptor for (CD16); Fc fragment of IgG, low affinity III, receptor for (CD16);Fc gammaRIV;Fc receptor-like 3;Fcgam;FcgammaRIV;Fcgr;Fcgr3a;FcgRIV;Fcrl3;low affinity immunoglobulin gamma Fc region receptor III-A;low affinity immunoglobulin gamma Fc region receptor IV
- Weitere Details:
- FcgammaRIV is a relatively new IgG Fc receptor (FcgammaR) that is reported to contribute to the pathogenesis of autoimmune diseases.FcgammaRIII and FcgammaRIV are each essential to trigger an FcRgamma-linker for activation of T-cell-dependent signal that drives C5a production in the Arthus reaction. A combined requirement for FcgammaRIII and FcgammaRIV in autoimmune injury, and identify the linker for activation of T cells adaptor as an integral component of linked FcgammaR and C5a anaphylatoxin receptor activation to generate inflammation.
- Versandbedingungen:
- Blue Ice