Recombinant Human Fc-gamma RIII alpha/CD16a(F176V) Protein

Größe

£133.00

SKU:: RP01366
Zusätzliche Namen:: CD16,CD16A,FCG3,FCGR3,FCGRIII,FCR-10,FCRIII,FCRIIIA,IGFR3,IMD20,FCGR3A
Molekulargewicht:: 40-55 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Gly17-Gln208(F176V)
Formulierung:: Recombinant Human Fc-gamma RIII alpha/CD16a(F176V) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly17-Gln208(F176V)) of human FCGR3A/CD16A(F176V) (Accession #NP_001121065.1) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
Uniprot:: P08637
Synonyme:: CD16;CD16A;CD16a antigen;Fc fragment of IgG, low affinity III, receptor for (CD16);Fc fragment of IgG, low affinity IIIa, receptor (CD16a);Fc gamma receptor III-A;Fc-gamma receptor III-2 (CD 16);Fc-gamma receptor IIIb (CD16);Fc-gamma RIII-alpha;FCG3;FcgammaRIIIA;FCGR3;FCGRIII;FCR-10;FCRIII;FCRIIIA;IGFR3;igG Fc receptor III-2;IMD20;immunoglobulin G Fc receptor III;low affinity immunoglobulin gamma Fc region receptor III-A;low affinity immunoglobulin gamma receptor III-a Fc fragment;neutrophil-specific antigen NA
Weitere Details:: This protein is a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other other antibody-dependent responses. The protein is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia.

Versandbedingungen:: Blue Ice