RP01362
Recombinant Human IL-3 Protein

Größe
£145.00
- SKU:
- RP01362
- Zusätzliche Namen:
- IL3,IL-3,MCGF,MULTI-CSF
- Molekulargewicht:
- 20-35 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ala20-Phe152
- Formulierung:
- Recombinant Human IL-3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala20-Phe152) of human interleukin-3/IL-3 (Accession #NP_000579.2) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
- Uniprot:
- P08700
- Synonyme:
- colony-stimulating factor, multiple;hematopoietic growth factor;IL-3;interleukin-3;Mast cell growth factor;mast-cell growth factor;MCGF;MULTI-CSF;multilineage-colony-stimulating factor;multipotential colony-stimulating factor;P-cell stimulating factor;P-cell-stimulating factor
- Weitere Details:
- IL3 (interleukin 3), also known as IL-3, is a potent growth-promoting cytokine that belongs to the IL-3 family. IL3/IL-3 also belongs to the group of interleukins. Interleukins are produced by a wide variety of body cells. The function of the immune system depends in a large part on interleukins, and rare deficiencies of a number of them have been described, all featuring autoimmune diseases or immune deficiency. The majority of interleukins are synthesized by helper CD4+ T lymphocytes, as well as through monocytes, macrophages, and endothelial cells. They promote the development and differentiation of T, B, and hematopoietic cells. IL3/IL-3 is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation, and apoptosis. IL3/IL-3 has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders.
- Versandbedingungen:
- Blue Ice



