Recombinant Human CD34 Protein

Größe

£127.00

SKU:: RP01359
Zusätzliche Namen:: CD34, CD34 molecule,CD34 molecule,GIG3,MORT1
Molekulargewicht:: 100-120 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Ser32-Thr290
Formulierung:: Recombinant Human CD34 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser32-Thr290) of human CD34 (Accession #NP_001020280.1) fused with a Fc, 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT
Uniprot:: P28906-1
Synonyme:: CD34 antigen;hematopoietic progenitor cell antigen CD34
Weitere Details:: The CD34 protein is a member of a family of single-pass transmembrane sialomucin proteins that show expression on early hematopoietic and vascular-associated tissue. CD34 is also an important adhesion molecule and is required for T cells to enter lymph nodes. It is expressed on lymph node endothelia whereas the L-selectin to which it binds is on the T cell. It was indicated that CD34 is a phosphorylation target for activated PKC, and couples to the hematopoietic adapter protein CrkL, which were involved in CD34 signaling pathways. CD34 is abberantly expressed in many kinds of tumors and is implicated in leukemogenesis.

Versandbedingungen:: Blue Ice