RP01340
Recombinant Mouse IL-1 beta Protein
Größe
£193.00
- SKU:
- RP01340
- Zusätzliche Namen:
- IL-1 beta,IL-, Il-1b, IL-1beta,Il1b
- Molekulargewicht:
- 19-20 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Val118-Ser269
- Formulierung:
- Recombinant Mouse IL-1 beta Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val118-Ser269) of mouse IL-1 beta (Accession #NP_032387.1) fused with 6xHis tag at the C-terminus.
- Spezies:
- Mouse
- Sequenz:
- VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVAL GLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNW YISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
- Uniprot:
- P10749
- Synonyme:
- IL-;IL-1 beta;Il-1b;IL-1beta;interleukin-1 beta
- Weitere Details:
- Interleukin-1 beta (IL1 beta or IL1B) also known as catabolin, is a member of the interleukin 1 cytokine family.This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity.
- Versandbedingungen:
- Blue Ice