RP01320
Recombinant Human IL-13 Protein
Größe
£145.00
- SKU:
- RP01320
- Zusätzliche Namen:
- IL13,IL-13,P600
- Molekulargewicht:
- 15 kDa, 25-35 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Gly35-Asn146
- Formulierung:
- Recombinant Human IL-13 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly35-Asn146) of Human IL13 (Accession #NP_002179.2) fused with an 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
- Uniprot:
- P35225
- Synonyme:
- IL-13;interleukin-13;P600
- Weitere Details:
- Interleukin 13 (IL13) is also known as ALRH,and P600, is a single-chain glycosylated polypeptide, and is a cytokine critical in regulating inflammatory and immune responses. IL13 is secreted by many cell types, but especially by T helper type 2 (Th2) cells. IL-13 induces its effects through a multi-subunit receptor that includes the alpha chain of the IL-4 receptor (IL-4RA Alpha) and at least one of two known IL-13-specific binding chains.As a cytokine, IL-13 protein is critical in regulating inflammatory, immune responses, and diseases. Also, it inhibits the production of pro-inflammatory cytokines and chemokines, and thus down-regulates macrophage activity. IL-13 protein and antibody are more importantly implicated as a central mediator of immunoregulatory processes in various cell types.
- Versandbedingungen:
- Blue Ice