Recombinant MERS-CoV Spike RBD Protein

Größe

£353.00

SKU:: RP01305
Zusätzliche Namen:: MERS-CoV Spike RBD
Molekulargewicht:: 60-70 kDa
Reinheit:: ≥90%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Glu367-Tyr606
Formulierung:: Recombinant MERS-CoV Spike RBD Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu367-Tyr606) of mers-cov Spike RBD (Accession #YP_009047204.1) fused with a K9N5Q8.
Spezies:: Virus
Sequenz:: EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEY
Uniprot:: K9N5Q8
Synonyme:: E2;G128_gp02;Peplomer protein;spike protein;surface glycoprotein
Weitere Details:: It's been reported that Coronavirus can infect the human respiratory epithelial cells through interaction with the human ACE2 receptor. The spike protein is a large type I transmembrane protein containing two subunits, S1 and S2. S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing the cell surface receptor. S2 contains basic elements needed for the membrane fusion.The S protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity.