RP01292
Recombinant Cynomolgus Siglec-15/CD33L3 Protein
Größe
£193.00
- SKU:
- RP01292
- Zusätzliche Namen:
- sialic acid-binding Ig-like lectin 15,CD33 antigen-like 3,SIGLEC15,Siglec15,SIGLEC15,sialic acid-binding Ig-like lectin 15,CD33 antigen-like 3,SIGLEC15,Siglec15,SIGLEC15
- Molekulargewicht:
- 60-70 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Phe20-Thr263
- Formulierung:
- Recombinant Cynomolgus Siglec-15/CD33L3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe20-Thr263) of cynomolgus Siglec-15/CD33L3 (Accession #XP_005586866.1) fused with a Fc, 6xHis tag at the C-terminus.
- Spezies:
- Non-human Primate
- Sequenz:
- FVRTKIDTTENLLNTEVHSSPAQRWSMQVPAEVSAAAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIINISVLPGPAHAFRALCTAEGEPPPALAWSGPALGNGSAAVPSSGQGHGHLVTAELPALNHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
- Uniprot:
- A0A2K5UY47
- Synonyme:
- sialic acid-binding Ig-like lectin 15
- Versandbedingungen:
- Blue Ice