RP01274LQ
Recombinant SARS-CoV-2 papain-like protease Protein
Größe
£133.00
- SKU:
- RP01274LQ
- Zusätzliche Namen:
- PLPro,PL-PRO,pp1a,Papain-like Protease,Replicase polyprotein 1a,ORF1a polyprotein,Plpro,COVID-19
- Molekulargewicht:
- 38 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Glu1564-Lys1878
- Formulierung:
- Recombinant SARS-CoV-2(2019-nCoV) papain-like protease is produced by E. coli expression system. The target protein is expressed with sequence (Glu1564-Lys1878) of SARS-COV-2(2019-nCoV) papain-like protease (Accession #YP_009725299.1) fused with an initial Met,a 6xHis tag at the N-terminus.
- Spezies:
- Virus
- Sequenz:
- EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK
- Synonyme:
- GU280_gp01;ORF1a polyprotein;ORF1ab polyprotein
- Versandbedingungen:
- Dry Ice