RP01263LQ
Recombinant SARS-CoV-2 Envelope Protein
Größe
Auf Anfrage
- SKU:
- RP01263LQ
- Zusätzliche Namen:
- 2019-nCoV E protein,2019-nCoV sM protein,Envelope protein,Env polyprotein,Envelope glycoprotein,env,COVID-19,E
- Molekulargewicht:
- 12 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Met1-Val75
- Formulierung:
- Recombinant SARS-CoV-2(2019-nCoV) Envelope Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Val75) of SARS-COV-2(2019-nCoV) Envelope (Accession #QHD43418.1) fused with an initial Met,a 6xHis,Avi tag at the N-terminus.
- Spezies:
- Virus
- Sequenz:
- MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
- Synonyme:
- envelope protein;GU280_gp04
- Versandbedingungen:
- Dry Ice