RP01257
Recombinant Human IL-15 Protein
Größe
£145.00
- SKU:
- RP01257
- Zusätzliche Namen:
- IL15,IL-15
- Molekulargewicht:
- 55-60 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Asn49-Ser162
- Formulierung:
- Recombinant Human IL-15 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn49-Ser162) of human IL-15 (Accession #NP_000576.1) fused with a Fc, 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
- Uniprot:
- P40933-1
- Synonyme:
- IL-15;interleukin-15
- Versandbedingungen:
- Blue Ice