RP01229
Recombinant Human CD24 Protein

Größe
£127.00
- SKU:
- RP01229
- Zusätzliche Namen:
- CD24,CD24A,CD24 molecule,CD247
- Molekulargewicht:
- 40-50 kDa
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Met1-Gly59
- Formulierung:
- Recombinant Human CD24 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gly59) of human CD24 (Accession #NP_037362) fused with a Fc tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG
- Uniprot:
- P25063
- Synonyme:
- CD24 antigen (small cell lung carcinoma cluster 4 antigen);CD24A;signal transducer CD24;Small cell lung carcinoma cluster 4 antigen
- Versandbedingungen:
- Blue Ice






